Protein Labeling Reagents
Cayman Chemical JWH 307 3-Isomer 10mg
An isomer of JWH 307 which differs by having the fluorophenyl group at the 3' position, rather than the 2' position, of the pyrrole group; intended for forensic and research purposes
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | C40H55ClN6O4 | 10MG
Cy5-PEG3-azide is a Cy5-labeled PEG3 azide reagent for click-chemistry labeling and linker applications. It enables copper-catalyzed azide-alkyne cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) to attach Cy5 fluorescence to alkyne-bearing molecules for bioconjugation, imaging, and PROTAC synthesis.
- Provides Cy5 fluorescence for detection and imaging.
- Contains a PEG3 spacer to improve solubility and reduce steric hindrance.
- Reactive azide functional group for CuAAC and SPAAC conjugations.
- Supplied as a dry powder for convenient storage and handling.
- Store protected from light at -20°C; in solvent, store at -80°C for long-term.
Abcam 5(6)-Carbo x y- x -rhodamine, 25MG
MW 1069.2 Da, Purity >90%. Stable, long wavelength, water soluble fluorophore has found widespread use in DNA-labeling, cell staining and protein labeling applications.
The product is subject to the following: Abcam Restricted Use Statement
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Akoya Biosciences TSA Plus TMR 50-150 Slides
TSA Plus tetramethylrhodamine (TMR) detection kit, for amplification of signal in immunohistochemistry (IHC), immunofluorescence (IF) or in situ hybridization protocols. This kit amplifies by depositing extra TMR in the localized area of the probe or antibody.
Aat Bioquest Cyanine 5 amine [equivalent to Cy5® amine]
A variety of cyanine 5 ( Cy5®) dyes has been used to label biological molecules for fluorescence imaging and other fluorescence-based biochemical analysis. They are widely used for labeling peptides, proteins and oligos etc.
Lumiprobe Sulfo-Cyanine5 NHS ester | 2230212-27-6 | MFCD30527435 | 50 mg
Sulfo-Cyanine5 NHS ester | Purity: 95% | Mol Wt: 777.95 | 2230212-27-6 | MFCD30527435 | 50 mg
![Aat Bioquest Tide Quencher™ 2WS maleimide [TQ2WS maleimide]](https://assets.fishersci.com/TFS-Assets/CCG/product-images/501953054.JPG-250.jpg)
Aat Bioquest Tide Quencher™ 2WS maleimide [TQ2WS maleimide]
TQ2WS is designed to be a superior quencher to FAM, HEX, TET, JOE, TF2 and rhodamine 6G. TQ2WS has (a). much stronger absorption; (b). much higher quenching efficiency; and (c).
Revvity Health Sciences Inc IVISense Cat K 680 FAST Fluorescent Probe
IVISense Cat K 680 FAST Fluorescent Probe
Medchemexpress LLC Lucifer yellow CH dilithium salt | 67769-47-5 | MFCD00006922 | 98.4% | 457.25 g/mol | C13H9Li2N5O9S2 | 5 MG
Lucifer Yellow CH dilithium salt is a water-soluble, high-intensity fluorescent tracer containing a hydrazide functional group. It is used for intracellular injection, neuronal morphology visualization, gap junction coupling studies, and other applications that require a polar, membrane-impermeant fluorescent probe.
- High fluorescence intensity for sensitive detection.
- Water-soluble formulation for easy dissolution in aqueous buffers.
- Excitation ~428-430 nm and emission ~536-540 nm for common fluorescence setups.
- Hydrazide group enables reaction with aldehydes for covalent labeling.
- Solid, yellow to orange appearance suitable for handling and storage.
- High purity (HPLC) for reproducible experimental performance.
Biotium CD34(ICO-115), CF568 conjugate, 0.1mg/mL
This antibody recognizes a carbohydrate epitope on a single chain, transmembrane, heavily glycosylated protein of 90-120 kDa, which is identified as CD34 (VI international workshop on human differentiation antigens). Its expression is a hallmark for identifying pluripotent hematopoietic stem or progenitor cells. Its expression is gradually lost as lineage committed progenitors differentiate. CD34 is a marker of choice for staining blasts in acute myeloid leukemia. In addition, it is expressed by soft tissue tumors, such as solitary fibrous tumor and gastrointestinal stromal tumor. CD34 expression is also found in vascular endothelium. Additionally, proliferating endothelial cells overexpress this molecule than the non-proliferating endothelial cells. Anti-CD34 labels > 85% of angiosarcoma and Kaposi's sarcoma, but shows low specificity.Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness